Recombinant Mouse Tnfrsf1b protein

• Cat.No.: Tnfrsf1b-847M
• Product Overview: Recombinant Mouse Tnfrsf1b protein was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 236
• Description: Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2 (By similarity).
• Form: Lyophilized from a 0.2 µm filtered solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-α mediated cytotoxicity in the L-929 cells is less than 2 μg/ml, corresponding to a specific activity of > 500 IU/mg in the presence of 0.1 ng/mL of rMuTNF-α.
• Molecular Mass: Approximately 25.3 kDa, a single non-glycosylated polypeptide chain containing 236 amino acids.
• AA Sequence: VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG
• Endotoxin: Less than 0.1 EU/µg of rMusTNF RII/TNFRSF1B as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Tnfrsf1b
• Official Symbol: Tnfrsf1b
• Synonyms: TNFRSF1B; tumor necrosis factor receptor superfamily, member 1b; tumor necrosis factor receptor superfamily member 1B; TNF-RII; TNFR-II; p75 TNFR; p80 TNF-alpha receptor; TNF receptor beta chain; tumor necrosis factor receptor 2; tumor necrosis factor receptor type II; p75; TNFBR; Tnfr2; CD120b; TNF-R2; TNFR80; TNFRII; Tnfr-1; TNF-R75; TNF-R-II; TNF-alphaR2; TNFalpha-R2
• Gene ID: 21938
• mRNA Refseq: NM_011610
• Protein Refseq: NP_035740
• UniProt ID: P25119