Recombinant Mouse TLR7 Protein (27-348 aa), GST-tagged

Cat.No. : TLR7-834M
Product Overview : Recombinant Mouse TLR7 Protein (27-348 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : GST
Protein Length : 27-348 aa
Description : Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 63.8 kDa
AA Sequence : FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Tlr7 toll-like receptor 7 [ Mus musculus ]
Official Symbol TLR7
Synonyms TLR7; toll-like receptor 7;
Gene ID 170743
mRNA Refseq NM_133211
Protein Refseq NP_573474
UniProt ID P58681

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TLR7 Products

Required fields are marked with *

My Review for All TLR7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon