Recombinant Mouse Tigit Protein, Fc-tagged

• Cat.No.: Tigit-731M
• Product Overview: Recombinant Mouse Tigit protein with Fc tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Fc
• ProteinLength: 241
• Description: Enables signaling receptor binding activity. Acts upstream of or within negative regulation of T cell activation. Predicted to be active in cell surface. Orthologous to human TIGIT (T cell immunoreceptor with Ig and ITIM domains).
• Form: Lyophilized
• Molecular Mass: 40 kDa
• AA Sequence: MHGWLLLVWVQGLIQAAFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKTG
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Tigit T cell immunoreceptor with Ig and ITIM domains [ Mus musculus (house mouse) ]
• Official Symbol: Tigit
• Synonyms: TIGIT; T cell immunoreceptor with Ig and ITIM domains; T-cell immunoreceptor with Ig and ITIM domains; V-set and transmembrane domain containing 3; V-set and transmembrane domain-containing protein 3; Vstm3; ENSMUSG00000071552
• Gene ID: 100043314
• mRNA Refseq: NM_001146325
• Protein Refseq: NP_001139797
• UniProt ID: https://www.uniprot.org/uniprot/A0A0B4J1G6