Recombinant Mouse Stc1 protein, His-GST-tagged

• Cat.No.: Stc1-20M
• Product Overview: Recombinant Mouse Stc1(Ser28~Ala247) fused with His-GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: GST&His
• Protein Length: Ser28-Ala247
• Form: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
• Molecular Mass: Predicted Molecular Mass: 54.7 kDa
  Accurate Molecular Mass: 55 kDa as determined by SDS-PAGE reducing conditions.
• AA Sequence: SPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGITSKVFLAIRRCSTFQEMIAEVQEDCYSKLNVCSIAKRNPEAITEVIQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEGDSPSHIKRTSQESA
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Purity: > 97%
• Applications: SDS-PAGE; WB; ELISA; IP; CoIP; Purification; Amine Reactive Labeling.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
• Concentration: 200ug/mL
• Reconstitution: Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
• Publications:
  Stanniocalcin 1 is a phagocytosis checkpoint driving tumor immune resistance (2021)

Gene Information

• Gene Name: Stc1 stanniocalcin 1 [ Mus musculus ]
• Official Symbol: Stc1
• Synonyms: STC1; stanniocalcin 1; stanniocalcin-1; STC-1; Stc
• Gene ID: 20855
• mRNA Refseq: NM_009285
• Protein Refseq: NP_033311
• UniProt ID: O55183