Recombinant Mouse SPINK2 Protein (17-86 aa), His-Myc-tagged
| Cat.No. : | SPINK2-2533M |
| Product Overview : | Recombinant Mouse SPINK2 Protein (17-86 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Inhibits trypsin in a dose-dependent manner. Required for maintenance of normal spermatogenesis. May be involved in regulating serine protease-dependent germ cell apoptosis. |
| Source : | E. coli |
| Species : | Mouse |
| Tag : | His&Myc |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 15.0 kDa |
| Protein length : | 17-86 aa |
| AA Sequence : | HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Spink2 serine peptidase inhibitor, Kazal type 2 [ Mus musculus (house mouse) ] |
| Official Symbol | SPINK2 |
| Synonyms | Spink2; HUSI-II; AV038945; 1700007F22Rik; |
| Gene ID | 69982 |
| mRNA Refseq | NM_001289768 |
| Protein Refseq | NP_001276697 |
| UniProt ID | Q8BMY7 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPINK2 Products
Required fields are marked with *
My Review for All SPINK2 Products
Required fields are marked with *
0
Inquiry Basket
