Recombinant Mouse Sost protein, hFc-tagged
Cat.No. : | Sost-4566M |
Product Overview : | Recombinant Mouse Sost protein(Q99P68)(24-211aa), fused to C-terminal hFc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Mammalian Cells |
Tag : | Fc |
Protein Length : | 24-211aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.1 kDa |
AA Sequence : | QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Sost sclerostin [ Mus musculus ] |
Official Symbol | Sost |
Synonyms | SOST; sclerostin; 5430411E23Rik; |
Gene ID | 74499 |
mRNA Refseq | NM_024449 |
Protein Refseq | NP_077769 |
◆ Recombinant Proteins | ||
Sost-010M | Recombinant Mouse Sost Protein, His-tagged | +Inquiry |
SOST-5332R | Recombinant Rat SOST Protein, His (Fc)-Avi-tagged | +Inquiry |
Sost-8577M | Recombinant Mouse Sost Protein, His (Fc)-Avi-tagged | +Inquiry |
Sost-4752R | Recombinant Rat Sost protein, His&Myc-tagged | +Inquiry |
SOST-4410R | Recombinant Rhesus monkey SOST Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOST-2846HCL | Recombinant Human SOST cell lysate | +Inquiry |
SOST-2251RCL | Recombinant Rat SOST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sost Products
Required fields are marked with *
My Review for All Sost Products
Required fields are marked with *
0
Inquiry Basket