Recombinant Mouse SLC1A2 Protein (143-238 aa), GST-tagged

• Cat.No.: SLC1A2-813M
• Product Overview: Recombinant Mouse SLC1A2 Protein (143-238 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: GST
• Protein Length: 143-238 aa
• Description: Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly roving released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 37.6 kDa
• AA Sequence: HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Slc1a2 solute carrier family 1 (glial high affinity glutamate transporter), member 2 [ Mus musculus ]
• Official Symbol: SLC1A2
• Synonyms: SLC1A2; GLT1; Eaat2; GLT-1; MGLT1; AI159670; 1700091C19Rik; 2900019G14Rik
• Gene ID: 20511
• mRNA Refseq: NM_001077514
• Protein Refseq: NP_001070982
• UniProt ID: P43006