Recombinant Mouse SIAE Protein, Full Length, C-His tagged

• Cat.No.: SIAE-15119M
• Product Overview: Recombinant Mouse SIAE Protein (Full Length) with C-His tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: Full Length
• Description: Predicted to enable sialate O-acetylesterase activity. Predicted to be involved in carbohydrate metabolic process and regulation of immune system process. Located in lysosome. Is expressed in several structures, including abdominal fat pad; central nervous system; dorsal aorta; genitourinary system; and yolk sac. Human ortholog(s) of this gene implicated in autoimmune disease. Orthologous to human SIAE (sialic acid acetylesterase).
• Molecular Mass: 59.7 kDa
• AA Sequence: AGIGFRFASYIDNYMVLQKEPSGAVIWGFGTPGATVTVTLCQGQETIMKKVTSVKEPSNTWMVVLDPMKPGGPFEVMAQQTLGTMNFTLRVHDVLFGDVWLCSGQSNMQMTVSQIFNASKELSDTAAYQSVRIFSVSLIQSEEELDDLTEVDLSWSKPTAGNLGHGNFTYMSAVCWLFGRYLYDTLQYPIGLVSSSWGGTYIEVWSSRRTLKACGVPNTRDERVGQPEIKPMRNECNSEESSCPFRVVPSVRVTGPTRHSVLWNAMIHPLQNMTLKGVVWYQGESNADYNRDLYTCMFPELIEDWRQTFHYGSQGQTDRFFPFGFVQLSSYMLKNSSDYGFPEIRWHQTADFGHVPNPKMPNTFMAVAIDLCDRDSPFGSIHPRDKQTVAYRLHLGARAVAYGEKNLTFQGPLPKKIELLASNGLLNLTYDQEIQVQMQDNKTFEISCCSDRHCKWLPAPVNTFSTQTLILDLNACLGTVVAVRYAWTTWPCEYKQCAVYHTSSMLPAPPFIAQISHRGIHHHHHHHH
• Purity: > 90% as determined by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.6 mg/mL
• Storage Buffer: PBS, pH 7.4
• Publications:
  Pregnancy enables antibody protection against intracellular infection (2022)

Gene Information

• Gene Name: Siae sialic acid acetylesterase [ Mus musculus (house mouse) ]
• Official Symbol: SIAE
• Synonyms: SIAE; sialic acid acetylesterase; sialate O-acetylesterase; clone 165; yolk sac gene 2; yolk sac protein 2; sialic acid-specific 9-O-acetylesterase; LSE; Ysg2
• Gene ID: 22619
• mRNA Refseq: NM_011734
• Protein Refseq: NP_035864
• UniProt ID: P70665