Recombinant Full Length Mouse SIAE Protein, His tagged
Cat.No. : | SIAE-15119M |
Availability | April 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-541 aa |
Description : | Predicted to enable sialate O-acetylesterase activity. Predicted to be involved in carbohydrate metabolic process and regulation of immune system process. Located in lysosome. Is expressed in several structures, including abdominal fat pad; central nervous system; genitourinary system; immune system; and yolk sac. Human ortholog(s) of this gene implicated in autoimmune disease. Orthologous to human SIAE (sialic acid acetylesterase). |
Molecular Mass : | 60 kDa |
AA Sequence : | AGIGFRFASYIDNYMVLQKEPSGAVIWGFGTPGATVTVTLCQGQETIMKKVTSVKEPSNTWMVVLDPMKPGGPFEVMAQQTLGTMNFTLRVHDVLFGDVWLCSGQSNMQMTVSQIFNASKELSDTAAYQSVRIFSVSLIQSEEELDDLTEVDLSWSKPTAGNLGHGNFTYMSAVCWLFGRYLYDTLQYPIGLVSSSWGGTYIEVWSSRRTLKACGVPNTRDERVGQPEIKPMRNECNSEESSCPFRVVPSVRVTGPTRHSVLWNAMIHPLQNMTLKGVVWYQGESNADYNRDLYTCMFPELIEDWRQTFHYGSQGQTDRFFPFGFVQLSSYMLKNSSDYGFPEIRWHQTADFGHVPNPKMPNTFMAVAIDLCDRDSPFGSIHPRDKQTVAYRLHLGARAVAYGEKNLTFQGPLPKKIELLASNGLLNLTYDQEIQVQMQDNKTFEISCCSDRHCKWLPAPVNTFSTQTLILDLNACLGTVVAVRYAWTTWPCEYKQCAVYHTSSMLPAPPFIAQISHRGIHHHHHHHH |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 0.22 mg/mL by BCA |
Publications : |
Pregnancy enables antibody protection against intracellular infection (2022)
|
Gene Name | Siae sialic acid acetylesterase [ Mus musculus (house mouse) ] |
Official Symbol | SIAE |
Synonyms | SIAE; sialic acid acetylesterase; sialate O-acetylesterase; clone 165; yolk sac gene 2; yolk sac protein 2; sialic acid-specific 9-O-acetylesterase; LSE; Ysg2 |
Gene ID | 22619 |
mRNA Refseq | NM_011734 |
Protein Refseq | NP_035864 |
UniProt ID | P70665 |
◆ Recombinant Proteins | ||
SIAE-3872Z | Recombinant Zebrafish SIAE | +Inquiry |
SIAE-189H | Recombinant Human SIAE protein, His-tagged | +Inquiry |
SIAE-7357H | Recombinant Human SIAE protein(Met1-Lys523), His-tagged | +Inquiry |
SIAE-4199R | Recombinant Rhesus monkey SIAE Protein, His-tagged | +Inquiry |
SIAE-694H | Recombinant Human SIAE Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIAE-001HCL | Recombinant Human SIAE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Siae Products
Required fields are marked with *
My Review for All Siae Products
Required fields are marked with *
0
Inquiry Basket