Recombinant Mouse SCGB3A2 Protein (22-139 aa), His-GST-tagged

• Cat.No.: SCGB3A2-2175M
• Product Overview: Recombinant Mouse SCGB3A2 Protein (22-139 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Mature Protein of Isoform C.

Specification

• Description: Enzyme and pathway databases.
• Source: E. coli
• Species: Mouse
• Tag: His&GST
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 43.2 kDa
• Protein length: 22-139 aa
• AA Sequence: LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Scgb3a2 secretoglobin, family 3A, member 2 [ Mus musculus ]
• Official Symbol: SCGB3A2
• Synonyms: SCGB3A2; pnSP-1; pneumo secretory protein 1; Pnsp1; UGRP1; LuLeu1; Utgrp1
• Gene ID: 117158
• mRNA Refseq: NM_054038
• Protein Refseq: NP_473379
• UniProt ID: Q920H1