Recombinant Mouse S100a1 Protein, His-tagged

Cat.No. : S100a1-7317M
Product Overview : Recombinant mouse S100A1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-94
Description : Probably acts as a Ca2+ signal transducer. In response to an increase in intracellular Ca2+ levels, binds calcium which triggers a conformational change. This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity.
Form : Liquid
Molecular Mass : 12.6 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS
Purity : > 90 %
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 30 % glycerol, 0.1 M NaCl
Gene Name S100a1 S100 calcium binding protein A1 [ Mus musculus (house mouse) ]
Official Symbol S100a1
Synonyms S100a1; S100 calcium binding protein A1; S10; S100; S100a; AI266795; protein S100-A1; S-100 protein alpha chain; S-100 protein subunit alpha
Gene ID 20193
mRNA Refseq NM_011309
Protein Refseq NP_035439
UniProt ID P56565

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All S100a1 Products

Required fields are marked with *

My Review for All S100a1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon