Recombinant Mouse Retn protein, His-tagged

• Cat.No.: Retn-3425M
• Product Overview: Recombinant Mouse Retn protein(Q99P87)(21-114aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 21-114aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 14.2 kDa
• AA Sequence: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Retn resistin [ Mus musculus ]
• Official Symbol: Retn
• Synonyms: RETN; resistin; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; dominant inhibitory adipocyte-specific secretory factor; adipose-specific cysteine-rich secreted protein A12-alpha; ADSF; Rstn; Xcp4; Fizz3
• Gene ID: 57264
• mRNA Refseq: NM_001204959
• Protein Refseq: NP_001191888