Recombinant Mouse Ptger4 protein

• Cat.No.: Ptger4-529M
• Product Overview: Recombinant Mouse Ptger4 protein(P32240)(361-513aa) was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 361-513aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 16.6 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: RKTVLSKAIEKIKCLFCRIGGSGRDSSAQHCSESRRTSSAMSGHSRSFLARELKEISSTSQTLLYLPDLTESSLGGRNLLPGSHGMGLTQADTTSLRTLRISETSDSSQGQDSESVLLVDEVSGSHREEPASKGNSLQVTFPSETLKLSEKCI

Gene Information

• Gene Name: Ptger4 prostaglandin E receptor 4 (subtype EP4) [ Mus musculus ]
• Official Symbol: Ptger4
• Synonyms: PTGER4; prostaglandin E receptor 4 (subtype EP4); prostaglandin E2 receptor EP4 subtype; prostanoid EP4 receptor; PGE receptor EP4 subtype; PGE2 receptor EP4 subtype; prostaglandin E receptor EP4 subtype; prostaglandin E receptor 4 (EP4 subtype); EP4; Ptgerep4
• Gene ID: 19219
• mRNA Refseq: NM_001136079
• Protein Refseq: NP_001129551