Recombinant Mouse PRND Protein (27-155 aa), His-Myc-tagged
Cat.No. : | PRND-2805M |
Product Overview : | Recombinant Mouse PRND Protein (27-155 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 27-155 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 18.9 kDa |
AA Sequence : | RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Prnd prion protein dublet [ Mus musculus ] |
Official Symbol | PRND |
Synonyms | PRND; prion protein dublet; prion-like protein doppel; doppelganger; prion protein-like protein; Dpl; PrPLP; doppel; AI450264; |
Gene ID | 26434 |
mRNA Refseq | NM_001126338 |
Protein Refseq | NP_001119810 |
UniProt ID | Q9QUG3 |
◆ Recombinant Proteins | ||
PRND-01H | Recombinant Human PRND Protein, His-tagged | +Inquiry |
PRND-649H | Recombinant Human PRND Protein, Fc-tagged | +Inquiry |
PRND-3434R | Recombinant Rhesus Macaque PRND Protein, His (Fc)-Avi-tagged | +Inquiry |
PRND-7224H | Recombinant Human PRND, His-tagged | +Inquiry |
PRND-5779H | Recombinant Human PRND Protein (Arg27-Gly152), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRND Products
Required fields are marked with *
My Review for All PRND Products
Required fields are marked with *
0
Inquiry Basket