Recombinant Mouse Prolactin / Prl Protein
Cat.No. : | Prl-001M |
Product Overview : | Recombinant mouse Prolactin protein (30-228aa) without tag, was expressed in E.coli and purified by using conventional chromatography techniques. |
Availability | April 25, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 30-228 a.a. |
Description : | Prolactin, also known as prl, is a hormone synthesized and secreted by lactotrope cells in the adenohypophysis (anterior pituitary gland). Prolactin has many effects, the most significant of which is to stimulate the mammary glands to produce milk (lactation). Increased serum prolactin during pregnancy causes enlargement of the mammary glands of the breasts and increases the production of milk. Recently, prolactin has demonstrated broader roles in breast cancer development, regulation of reproductive function, and immuno-regulation. |
Form : | Liquid |
Molecular Mass : | 22.7 kDa |
Endotoxin : | < 1.0 EU per 1 μg of protein (determined by LAL method) |
Purity : | > 90% by SDS - PAGE |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1.0 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | In Phosphate buffered saline (pH 7.4) |
Warning : | For research use only. This product is not intended or approved for human, diagnostics or veterin |
AA Sequence : | MQPLPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC |
Gene Name | Prl prolactin [ Mus musculus (house mouse) ] |
Official Symbol | Prl |
Synonyms | Prl; prolactin; Gha1; Prl1a1; AV290867; prolactin; growth hormone a1 |
Gene ID | 19109 |
mRNA Refseq | NM_011164 |
Protein Refseq | NP_035294 |
UniProt ID | Q9CPQ2 |
◆ Recombinant Proteins | ||
PRL-3429R | Recombinant Rhesus Macaque PRL Protein, His (Fc)-Avi-tagged | +Inquiry |
PRL-0044H | Recombinant Human PRL Protein | +Inquiry |
PRL-3611R | Recombinant Rhesus monkey PRL Protein, His-tagged | +Inquiry |
Prl-60R | Active Recombinant Rat Prolactin / Prl protein | +Inquiry |
PRL-1195C | Recombinant Chicken PRL Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
PRL-8245H | Native Human Prolactin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Prl Products
Required fields are marked with *
My Review for All Prl Products
Required fields are marked with *
0
Inquiry Basket