Recombinant Mouse Pf4 protein, His-SUMO-tagged
Cat.No. : | Pf4-3331M |
Product Overview : | Recombinant Mouse Pf4 protein(Q9Z126)(30-105aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 30-105aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.2 kDa |
AA Sequence : | VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Pf4 platelet factor 4 [ Mus musculus ] |
Official Symbol | Pf4 |
Synonyms | PF4; platelet factor 4; PF-4; C-X-C motif chemokine 4; chemokine (C-X-C motif) ligand 4; Cxcl4; Scyb4; |
Gene ID | 56744 |
mRNA Refseq | NM_019932 |
Protein Refseq | NP_064316 |
◆ Recombinant Proteins | ||
PF4-1181H | Recombinant Horse PF4 Protein, His-tagged | +Inquiry |
PF4-647P | Recombinant Pig PF4 protein, mFc-tagged | +Inquiry |
PF4-6754H | Recombinant Human PF4 protein, hFc-tagged | +Inquiry |
Pf4-159M | Recombinant Mouse Pf4 Protein, His-tagged | +Inquiry |
Pf4-37M | Recombinant Mouse Pf4 Protein, Biotin-tagged | +Inquiry |
◆ Native Proteins | ||
PF4-253H | Native Human Platelet Factor 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PF4-3283HCL | Recombinant Human PF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pf4 Products
Required fields are marked with *
My Review for All Pf4 Products
Required fields are marked with *
0
Inquiry Basket