Recombinant Mouse P2RX4 Protein (55-338 aa), His-SUMO-tagged

• Cat.No.: P2RX4-2736M
• Product Overview: Recombinant Mouse P2RX4 Protein (55-338 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Extracellular Domain.

Specification

• Description: Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin (By similarity).
• Source: E. coli Cell Free
• Species: Mouse
• Tag: His&SUMO
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 47.5 kDa
• Protein length: 55-338 aa
• AA Sequence: QETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDKTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTDPFCPIFRLGQIVADAGHSFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMIN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: P2rx4 purinergic receptor P2X, ligand-gated ion channel 4 [ Mus musculus ]
• Official Symbol: P2RX4
• Synonyms: P2RX4; P2X purinoceptor 4; ATP receptor; ionotropic purinergic receptor; P2X4; AI504491; AW555605; D5Ertd444e
• Gene ID: 18438
• mRNA Refseq: NM_011026
• Protein Refseq: NP_035156
• UniProt ID: Q9JJX6