Recombinant Mouse Npy2r protein, His-tagged

• Cat.No.: Npy2r-3289M
• Product Overview: Recombinant Mouse Npy2r protein(P97295)(1-51aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-51aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 11.0 kDa
• AA Sequence: MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Npy2r neuropeptide Y receptor Y2 [ Mus musculus ]
• Official Symbol: Npy2r
• Synonyms: NPY2R; neuropeptide Y receptor Y2; neuropeptide Y receptor type 2; Y2 receptor; NPY-Y2 receptor; NPY2-R; MGC124241; MGC124242; MGC124244
• Gene ID: 18167
• mRNA Refseq: NM_001205099
• Protein Refseq: NP_001192028