Recombinant Mouse MUC1 Protein, His-tagged

• Cat.No.: MUC1-77M
• Product Overview: Recombinant Mouse MUC1 Protein, fused to His-tag, was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Description: Predicted to enable RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; p53 binding activity; and transcription coregulator activity. Predicted to be involved in several processes, including DNA damage response, signal transduction by p53 class mediator; negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator; and regulation of transcription, DNA-templated. Located in apical plasma membrane and cell surface. Is expressed in several structures, including brain; exocrine gland; genitourinary system; gut; and respiratory system. Human ortholog(s) of this gene implicated in several diseases, including allergic rhinitis; biliary tract benign neoplasm; dry eye syndrome; familial juvenile hyperuricemic nephropathy; and pancreatic cancer (multiple). Orthologous to human MUC1 (mucin 1, cell surface associated).
• Form: Lyophilized from a 0.2μm filtered solution of PBS and 5% mannitol, 5% trehalose.
• Molecular Mass: 19.3 kDa
• AA Sequence: HHHHHHTSSVLGSATSLVYNTSAIATTPVSNGTQPSVPSQYPVSPTMATTSSHSTIASSSYYSTVPFSTFSSNSSPQLSVGVSFFFLSFYIQNHPFNSSLEDPSSNYYQELKRNISGLFLQIFNGDFLGISSIKFRSGSVVVESTVVFREGTFSASDVKSQLIQHKKEADDYNLTIS
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: Muc1 mucin 1, transmembrane [ Mus musculus (house mouse) ]
• Official Symbol: MUC1
• Synonyms: EMA; CD227; Muc-1
• Gene ID: 17829
• mRNA Refseq: NM_013605
• Protein Refseq: NP_038633
• UniProt ID: Q02496