Recombinant Mouse Ms4a1 protein, His/SUMO-tagged
Cat.No. : | Ms4a1-4893M |
Product Overview : | Recombinant Mouse Ms4a1(132-291aa) fused with His-SUMO tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 132-291aa |
Molecular Mass : | 34.1kD |
AA Sequence : | ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGI VENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQE QESLPVENEIAP |
Gene Name | Ms4a1 membrane-spanning 4-domains, subfamily A, member 1 [ Mus musculus ] |
Official Symbol | Ms4a1 |
Synonyms | MS4A1; membrane-spanning 4-domains, subfamily A, member 1; B-lymphocyte antigen CD20; CD20 antigen; lymphocyte antigen 44; B-cell differentiation antigen Ly-44; membrane-spanning 4-domains, subfamily A, member 2; Cd20; Ly-44; Ms4a2; AA960661; |
Gene ID | 12482 |
mRNA Refseq | NM_007641 |
Protein Refseq | NP_031667 |
MIM | |
UniProt ID | P19437 |
Chromosome Location | 19 8.19 cM; 19 B |
Pathway | Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
Function | epidermal growth factor receptor binding; |
◆ Recombinant Proteins | ||
ANKRD34B-1451HF | Recombinant Full Length Human ANKRD34B Protein, GST-tagged | +Inquiry |
CISD1-1416R | Recombinant Rat CISD1 Protein | +Inquiry |
ACVR2A-0785H | Recombinant Human ACVR2A Protein (P191-N487), Tag Free | +Inquiry |
GSTM2-321C | Recombinant Cynomolgus Monkey GSTM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
APBA2-9728H | Recombinant Human APBA2, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
a-Actinin-855C | Native Porcine a-Actinin Protein | +Inquiry |
FTH1-28156TH | Native Human FTH1 | +Inquiry |
HDL-1539HB | Native Human High-density lipoprotein, Biotinylated | +Inquiry |
FLNA-873T | Native Turkey FLNA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MACROD1-399HCL | Recombinant Human MACROD1 lysate | +Inquiry |
PITPNB-3166HCL | Recombinant Human PITPNB 293 Cell Lysate | +Inquiry |
SERTM1-8297HCL | Recombinant Human C13orf36 293 Cell Lysate | +Inquiry |
SESN2-1930HCL | Recombinant Human SESN2 293 Cell Lysate | +Inquiry |
Placenta-387H | Human Placenta Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ms4a1 Products
Required fields are marked with *
My Review for All Ms4a1 Products
Required fields are marked with *
0
Inquiry Basket