Recombinant Mouse MERTK protein(19-497aa), His-tagged

• Cat.No.: MERTK-0515M
• Product Overview: Recombinant Mouse MERTK protein(Q60805)(19-497aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Mouse
• Tag: His
• Protein length: 19-497 a.a.
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Mertk at 2 μg/mL can bind anti-MERTK recombinant antibody, the EC50 is 19.22-25.80 ng/mL.
• Molecular Mass: 55.0 kDa
• AASequence: GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSM
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Mertk c-mer proto-oncogene tyrosine kinase [ Mus musculus ]
• Official Symbol: MERTK
• Synonyms: MERTK; c-mer proto-oncogene tyrosine kinase; tyrosine-protein kinase Mer; Tyro 12; proto-oncogene c-Mer; receptor tyrosine kinase MerTK; proto-oncogene tyrosine-protein kinase Mer; Eyk; Mer; Nyk; nmf12
• Gene ID: 17289
• mRNA Refseq: NM_008587
• Protein Refseq: NP_032613