Recombinant Mouse Mapk14 protein, His&Myc-tagged

• Cat.No.: Mapk14-7876M
• Product Overview: Recombinant Mouse Mapk14 protein(P47811)(2-360aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 2-360aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.6 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Gene Information

• Gene Name: Mapk14 mitogen-activated protein kinase 14 [ Mus musculus ]
• Official Symbol: Mapk14
• Synonyms: MAPK14; mitogen-activated protein kinase 14; MAPK 14; p38 MAPK; p38 alpha; MAP kinase 14; MAP kinase p38 alpha; p38 MAP kinase alpha; tRNA synthetase cofactor p38; mitogen activated protein kinase 14; mitogen-activated protein kinase p38 alpha; cytokine suppressive anti-inflammatory drug binding protein 1; p38; Crk1; Mxi2; p38a; CSBP2; Csbp1; PRKM14; PRKM15; p38MAPK; p38alpha; p38-alpha; MGC102436
• Gene ID: 26416
• mRNA Refseq: NM_001168508
• Protein Refseq: NP_001161980