Recombinant Mouse LY6E Protein (21-102 aa), His-B2M-tagged

• Cat.No.: LY6E-2189M
• Product Overview: Recombinant Mouse LY6E Protein (21-102 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: B2M&His
• Protein Length: 21-102 aa
• Description: Involved in T-cell development.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.8 kDa
• AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Ly6e lymphocyte antigen 6 complex, locus E [ Mus musculus ]
• Official Symbol: LY6E
• Synonyms: LY6E; 9804; Ly67; Tsa1; RIG-E; Sca-2; TSA-1
• Gene ID: 17069
• mRNA Refseq: NM_001164036
• Protein Refseq: NP_001157508
• UniProt ID: Q64253