Recombinant Mouse Lilrb4 Protein, Fc-tagged

• Cat.No.: Lilrb4-361M
• Product Overview: Recombinant Mouse Lilrb4 protein with Fc tag was expressed in HEK293.

Specification

• Description: Enables integrin binding activity. Involved in negative regulation of mast cell activation involved in immune response. Acts upstream of or within several processes, including alpha-beta T cell proliferation; cellular response to lipopolysaccharide; and response to nematode. Located in external side of plasma membrane. Is expressed in urinary system. Orthologous to human LILRB4 (leukocyte immunoglobulin like receptor B4).
• Source: HEK293
• Species: Mouse
• Tag: Fc
• Form: Lyophilized
• Molecular Mass: 50.7 kDa
• Protein length: 335
• AA Sequence: MIAMLTVLLYLGLILEPRTAVQAGHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKILIGVLVSFLLLFFLLLFLILIGYQYGHKKKANASVKNTQSENNAELNSWNPQNEDPQGIVYAQVKPSRLQKDTACKETQDVTYAQLCIRTQEQNNS
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Lilrb4 leukocyte immunoglobulin-like receptor, subfamily B, member 4 [ Mus musculus (house mouse) ]
• Official Symbol: Lilrb4
• Synonyms: HM18; ILT3; gp49; CD85K; Gp49b; LIR-5
• Gene ID: 14728
• mRNA Refseq: NM_013532
• Protein Refseq: NP_038560
• UniProt ID: Q64281