Recombinant Mouse LILRB3 Protein (664-841 aa), His-tagged
Cat.No. : | LILRB3-1445M |
Product Overview : | Recombinant Mouse LILRB3 Protein (664-841 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 664-841 aa |
Description : | May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.6 kDa |
AA Sequence : | RRRHRGKFRKDVQKEKDLQLSSGAEEPITRKGELQKRPNPAAATQEESLYASVEDMQTEDGVELNSWTPPEEDPQGETYAQVKPSRLRKAGHVSPSVMSREQLNTEYEQAEEGQGANNQAAESGESQDVTYAQLCSRTLRQGAAASPLSQAGEAPEEPSVYATLAAARPEAVPKDMEQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Lilrb3 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3 [ Mus musculus ] |
Official Symbol | LILRB3 |
Synonyms | LILRB3; Gp91; Pirb; LIR-3; PIR-B; |
Gene ID | 18733 |
mRNA Refseq | NM_011095 |
Protein Refseq | NP_035225 |
UniProt ID | P97484 |
◆ Recombinant Proteins | ||
LILRB3-535H | Recombinant Human LILRB3 Protein (Met1-Glu443), His-tagged, Biotinylated | +Inquiry |
LILRB3-0372H | Recombinant Human LILRB3 protein, Fc-tagged | +Inquiry |
LILRB3-219H | Active Recombinant Human LILRB3, Fc Chimera | +Inquiry |
LILRB3-522HB | Active Recombinant Human LILRB3 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
LILRB3-3955H | Recombinant Human LILRB3 Protein (Met1-Glu443), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB3-1653MCL | Recombinant Mouse LILRB3 cell lysate | +Inquiry |
LILRB3-2208HCL | Recombinant Human LILRB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LILRB3 Products
Required fields are marked with *
My Review for All LILRB3 Products
Required fields are marked with *
0
Inquiry Basket