Recombinant Mouse LILRB3 Protein (664-841 aa), His-tagged

• Cat.No.: LILRB3-1445M
• Product Overview: Recombinant Mouse LILRB3 Protein (664-841 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Description: May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM).
• Source: Yeast
• Species: Mouse
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 21.6 kDa
• Protein length: 664-841 aa
• AA Sequence: RRRHRGKFRKDVQKEKDLQLSSGAEEPITRKGELQKRPNPAAATQEESLYASVEDMQTEDGVELNSWTPPEEDPQGETYAQVKPSRLRKAGHVSPSVMSREQLNTEYEQAEEGQGANNQAAESGESQDVTYAQLCSRTLRQGAAASPLSQAGEAPEEPSVYATLAAARPEAVPKDMEQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Lilrb3 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3 [ Mus musculus ]
• Official Symbol: LILRB3
• Synonyms: LILRB3; Gp91; Pirb; LIR-3; PIR-B
• Gene ID: 18733
• mRNA Refseq: NM_011095
• Protein Refseq: NP_035225
• UniProt ID: P97484