Recombinant Mouse Lgals3 Protein, His-tagged

• Cat.No.: Lgals3-7260M
• Product Overview: Recombinant mouse LGALS3 protein, used to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Description: Biased expression in colon adult (RPKM 931.1), duodenum adult (RPKM 311.5) and 8 other tissues.
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Liquid
• Molecular Mass: 29.8 kDa
• Protein length: 1-264
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 0.15 M NaCl, 50 % glycerol,1 mM DTT, 2 mM EDTA

Gene Information

• Gene Name: Lgals3 lectin, galactose binding, soluble 3 [ Mus musculus (house mouse) ]
• Official Symbol: Lgals3
• Synonyms: Lgals3; lectin, galactose binding, soluble 3; ga; GBP; L-3; L-34; Mac-; gal3; Mac-2; galect; galectin-3; 35 kDa lectin; CBP 35; L-34 galactoside-binding lectin; carbohydrate-binding protein 35; gal-3; galactose-specific lectin 3; igE-binding protein; laminin-binding protein; lectin L-29; mac-2 antigen
• Gene ID: 16854
• mRNA Refseq: NM_001145953
• Protein Refseq: NP_001139425
• UniProt ID: Q8C253