Recombinant Mouse Kdelr2 Full Length Transmembrane protein, His-tagged

Cat.No. : Kdelr2-024M
Product Overview : Recombinant Mouse Kdelr2 protein(Q9CQM2)(1-212aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : In vitro E. coli expression system
Species : Mouse
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.0 kDa
Protein length : 1-212aa
AA Sequence : MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Kdelr2 KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2 [ Mus musculus ]
Official Symbol Kdelr2
Synonyms KDELR2; KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2; ER lumen protein retaining receptor 2; KDEL receptor 2; KDEL endoplasmic reticulum protein retention receptor 2; 1110007A14Rik;
Gene ID 66913
mRNA Refseq NM_025841
Protein Refseq NP_080117

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Kdelr2 Products

Required fields are marked with *

My Review for All Kdelr2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon