Recombinant Mouse Kdelr2 Full Length Transmembrane protein, His-tagged

• Cat.No.: Kdelr2-024M
• Product Overview: Recombinant Mouse Kdelr2 protein(Q9CQM2)(1-212aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Source: In vitro E. coli expression system
• Species: Mouse
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.0 kDa
• Protein length: 1-212aa
• AA Sequence: MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Kdelr2 KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2 [ Mus musculus ]
• Official Symbol: Kdelr2
• Synonyms: KDELR2; KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 2; ER lumen protein retaining receptor 2; KDEL receptor 2; KDEL endoplasmic reticulum protein retention receptor 2; 1110007A14Rik
• Gene ID: 66913
• mRNA Refseq: NM_025841
• Protein Refseq: NP_080117