Recombinant Mouse Jun protein, His-tagged
Cat.No. : | Jun-5214M |
Product Overview : | Recombinant Mouse Jun protein(P05627)(1-334aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-334aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
Gene Name | Jun Jun oncogene [ Mus musculus ] |
Official Symbol | Jun |
Synonyms | JUN; Jun oncogene; transcription factor AP-1; AP1; AH119; jun A; immediate early; activator protein 1; proto-oncogene c-jun; V-jun avian sarcoma virus 17 oncogene homolog; AP-1; Junc; c-jun; |
Gene ID | 16476 |
mRNA Refseq | NM_010591 |
Protein Refseq | NP_034721 |
◆ Recombinant Proteins | ||
JUN-3146R | Recombinant Rat JUN Protein | +Inquiry |
JUN-1499G | Recombinant Gallus gallus JUN Protein (Ser228-Gly298), N-His tagged | +Inquiry |
JUN-646H | Recombinant Human Jun Oncogene, GST-tagged | +Inquiry |
JUN-3133H | Recombinant Human JUN Protein (Asp11-Asn262), N-His tagged | +Inquiry |
JUN-715HF | Recombinant Full Length Human JUN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JUN-5095HCL | Recombinant Human JUN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Jun Products
Required fields are marked with *
My Review for All Jun Products
Required fields are marked with *
0
Inquiry Basket