Recombinant Mouse Jun protein, His-tagged

• Cat.No.: Jun-5214M
• Product Overview: Recombinant Mouse Jun protein(P05627)(1-334aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-334aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 41.9 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Gene Information

• Gene Name: Jun Jun oncogene [ Mus musculus ]
• Official Symbol: Jun
• Synonyms: JUN; Jun oncogene; transcription factor AP-1; AP1; AH119; jun A; immediate early; activator protein 1; proto-oncogene c-jun; V-jun avian sarcoma virus 17 oncogene homolog; AP-1; Junc; c-jun
• Gene ID: 16476
• mRNA Refseq: NM_010591
• Protein Refseq: NP_034721