Recombinant Mouse Ins2 protein, His&Myc-tagged
Cat.No. : | Ins2-4180M |
Product Overview : | Recombinant Mouse Ins2 protein(P01326)(25-110aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 25-110aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.9 kDa |
AA Sequence : | FVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Ins2 insulin II [ Mus musculus ] |
Official Symbol | Ins2 |
Synonyms | INS2; insulin II; insulin-2; Mody; Ins-2; InsII; Mody4; AA986540; proinsulin; |
Gene ID | 16334 |
mRNA Refseq | NM_001185083 |
Protein Refseq | NP_001172012 |
◆ Recombinant Proteins | ||
Ins2-3551M | Recombinant Mouse Ins2 Protein, Myc/DDK-tagged | +Inquiry |
INS2-4561M | Recombinant Mouse INS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
INS2-3077R | Recombinant Rat INS2 Protein | +Inquiry |
INS2-8234M | Recombinant Mouse INS2 Protein | +Inquiry |
INS2-2733R | Recombinant Rat INS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ins2 Products
Required fields are marked with *
My Review for All Ins2 Products
Required fields are marked with *
0
Inquiry Basket