Recombinant Mouse Il1f8 protein

• Cat.No.: Il1f8-647M
• Product Overview: Recombinant Mouse Il1f8 protein (Met1-Lys183) was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• ProteinLength: 183
• Description: Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. IL-36 beta is reported to be expressed at higher levels in psoriatic plaques than in symptomless psoriatic skin or healthy control skin and it can stimulate production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes. It beta has two isoforms. IL-36β isoform 2 contains one potential N-linked glycosylation site in its C-terminus, while IL -36β isoform 1 lacks potential N-linked glycosylation sites and four of the conserved β-strands. Within the IL-1 family, IL-36β/IL-1F8 shares 30 %, 32 %, 37 %, 46 %, 34 %, 45 % and 28 % a.a. sequence identity with IL-1 ra, IL-1β, IL-36Ra/IL-1F5, IL-36α/IL-1F6, IL-37/IL-1F7, IL-36γ/IL-1F9 and IL-1F10, respectively.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, 300 mM NaCl, pH 8.0, 5 % trehalose.
• Bio-activity: Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rMuIL-36β at 1 µg/mL can bind recombinant murine IL-1 Rrp2 with a range of 0.15-5 µg/mL.
• Molecular Mass: Approximately 20.9 kDa, a single non-glycosylated polypeptide chain containing 183 amino acids.
• AA Sequence: MMAFPPQSCVHVLPPKSIQMWEPNHNTMHGSSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK
• Endotoxin: Less than 1 EU/μg of rMuIL-36β, 183a.a. as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il1f8
• Official Symbol: Il1f8
• Synonyms: IL1F8; interleukin 1 family, member 8; interleukin-36 beta; IL-1F8; interleukin-1 family member 8; Il36b; 2310043N20Rik
• Gene ID: 69677
• mRNA Refseq: NM_027163
• Protein Refseq: NP_081439
• UniProt ID: Q9D6Z6