Recombinant Mouse IL1F10 Protein (1-152 aa), His-SUMO-tagged

• Cat.No.: IL1F10-2095M
• Product Overview: Recombinant Mouse IL1F10 Protein (1-152 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length.

Specification

• Description: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2 (By similarity).
• Source: E. coli
• Species: Mouse
• Tag: His&SUMO
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 33.1 kDa
• Protein length: 1-152 aa
• AA Sequence: MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Il1f10 interleukin 1 family, member 10 [ Mus musculus ]
• Official Symbol: IL1F10
• Synonyms: IL1F10; IL-1F10; MGC130267; MGC130268
• Gene ID: 215274
• mRNA Refseq: NM_153077
• Protein Refseq: NP_694717
• UniProt ID: Q8R459