Recombinant Mouse IL1F10 Protein (1-152 aa), His-SUMO-tagged
Cat.No. : | IL1F10-2095M |
Product Overview : | Recombinant Mouse IL1F10 Protein (1-152 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-152 aa |
Description : | Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2 (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.1 kDa |
AA Sequence : | MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Il1f10 interleukin 1 family, member 10 [ Mus musculus ] |
Official Symbol | IL1F10 |
Synonyms | IL1F10; IL-1F10; MGC130267; MGC130268; |
Gene ID | 215274 |
mRNA Refseq | NM_153077 |
Protein Refseq | NP_694717 |
UniProt ID | Q8R459 |
◆ Recombinant Proteins | ||
IL1F10-15884H | Recombinant Human IL1F10, His-tagged | +Inquiry |
IL1F10-187H | Recombinant Human IL1F10 protein(Met1-Trp152), His-tagged | +Inquiry |
IL1F10-400H | Active Recombinant Human Interleukin 1 Family, Member 10 (Theta) | +Inquiry |
Il1f10-3504M | Recombinant Mouse Il1f10 Protein, Myc/DDK-tagged | +Inquiry |
Il1f10-82M | Recombinant Mouse Il1f10 Protein (Met1-Arg152), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1F10-5241HCL | Recombinant Human IL1F10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1F10 Products
Required fields are marked with *
My Review for All IL1F10 Products
Required fields are marked with *
0
Inquiry Basket