Recombinant Mouse Hbb-bt Protein, Full Length, C-Myc/DDK tagged

• Cat.No.: Hbb-bt-14MFL
• Product Overview: Purified recombinant protein of Mouse hemoglobin, beta adult major chain (Hbb-b1), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Myc&DDK
• ProteinLength: Full Length
• Description: This gene encodes a beta polypeptide chain found in adult hemoglobin, which consists of a tetramer of two alpha chains and two beta chains, and which functions in the transport of oxygen to various peripheral tissues. This gene is one of a cluster of beta-hemoglobin genes that are distally regulated by a locus control region, and which are organized along the chromosome in the order of their developmental expression. In mouse, two major strain-specific haplotypes of the beta-globin gene cluster are found - a "single" haplotype found in C57BL/-type strains, which includes two highly similar adult beta-globin genes, beta s and beta t, and a "diffuse" haplotype found in strains such as BALB/c and 129Sv, which includes two somewhat diverse adult beta-globin genes, beta-major and beta-minor. This gene represents the beta t adult gene found in the "single" haplotype. Primary chromosome 7 of the mouse reference genome assembly, which is derived from C57BL/6 strain mice, represents the "single" haplotype, while the "diffuse" haplotype is represented in the reference genome collection by the BALB/c strain alternate contig, NT_095534.1. [provided by RefSeq, May 2013]
• Molecular Mass: 16.2 kDa
• AA Sequence: MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKVKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGKDFTPAAQAAFQKVVAGVAAALAHKYHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions.
• Concentration: > 0.05 μg/μL as determined by microplate BCA method
• Storage Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol

Gene Information

• Gene Name: Hbb-bt hemoglobin, beta adult t chain [ Mus musculus (house mouse) ]
• Official Symbol: Hbb-bt
• Synonyms: Hbb-bt; hemoglobin, beta adult t chain; Beta-t; hemoglobin, beta adult t chain; beta t
• Gene ID: 101488143
• mRNA Refseq: NM_008220
• Protein Refseq: NP_032246
• UniProt ID: A8DUK4