Recombinant Mouse HAS2 Protein (67-374 aa), His-tagged
Cat.No. : | HAS2-547M |
Product Overview : | Recombinant Mouse HAS2 Protein (67-374 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 67-374 aa |
Description : | Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most Extracellular domain matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction and it is particularly responsible for the synthesis of high molecular mass hyaluronan. Required for the transition of endocardial cushion cells into mesenchymal cells, a process crucial for heart development. May also play a role in vasculogenesis. High molecular mass hyaluronan also play a role in early contact inhibition a process which stops cell growth when cells come into contact with each other or the Extracellular domain matrix. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 39.9 kDa |
AA Sequence : | EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Has2 hyaluronan synthase 2 [ Mus musculus (house mouse) ] |
Official Symbol | HAS2 |
Gene ID | 15117 |
mRNA Refseq | NM_008216 |
Protein Refseq | NP_032242 |
UniProt ID | P70312 |
◆ Recombinant Proteins | ||
HAS2-3382M | Recombinant Mouse HAS2 protein, His-tagged | +Inquiry |
HAS2-9457Z | Recombinant Zebrafish HAS2 | +Inquiry |
HAS2-2446R | Recombinant Rat HAS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAS2-7486M | Recombinant Mouse HAS2 Protein | +Inquiry |
Has2-3018M | Recombinant Mouse Has2 protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAS2 Products
Required fields are marked with *
My Review for All HAS2 Products
Required fields are marked with *
0
Inquiry Basket