Recombinant Mouse Golm1 protein, His-SUMO-tagged

• Cat.No.: Golm1-2982M
• Product Overview: Recombinant Mouse Golm1 protein(Q91XA2)(36-393aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 36-393aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 56.6 kDa
• AA Sequence: SSRSVELQTRIVELEGRVRRAAAERGAVELKKNEFQGELQKQREQLDRIQSSHSFQLENVNKLHQDEKAVLVNNITTGEKLIRDLQDQLKALQRSYSSLQQDIFQFQKNQTSLEKKFSYDLNQCISQMTEVKEQCDERIEEVIRKRNEAPGSRDLAETNNQHQQALKPQPKLQEEVPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQVQNEETNEIQAVGEEHQQASIQGQAVADGTRVGAEKLDQHTQLPAGLLARPEEDSQYPEREQLVIRDRQEQQRASEEGGGQKNPGDEYDMDENEAESEREKQAALAGNDRNINVLNADAQKRGIINVPVGSERQSHILNQVGIHIPQQA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Golm1 golgi membrane protein 1 [ Mus musculus ]
• Official Symbol: Golm1
• Synonyms: GOLM1; golgi membrane protein 1; Golgi membrane protein 1; golgi phosphoprotein 2; golgi membrane protein GP73; GP73; Golph2; AW125446; PSEC0257; 2310001L02Rik; D030064E01Rik; MGC107447
• Gene ID: 105348
• mRNA Refseq: NM_001035122
• Protein Refseq: NP_001030294