Recombinant Mouse GCGR Protein (27-143 aa), GST-tagged
Cat.No. : | GCGR-518M |
Product Overview : | Recombinant Mouse GCGR Protein (27-143 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Description : | G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger syst. |
Source : | E. coli |
Species : | Mouse |
Tag : | GST |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 40.8 kDa |
Protein length : | 27-143 aa |
AA Sequence : | AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Gcgr glucagon receptor [ Mus musculus ] |
Official Symbol | GCGR |
Synonyms | GCGR; glucagon receptor; GL-R; GR; |
Gene ID | 14527 |
mRNA Refseq | NM_008101 |
Protein Refseq | NP_032127 |
UniProt ID | Q61606 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GCGR Products
Required fields are marked with *
My Review for All GCGR Products
Required fields are marked with *
0
Inquiry Basket