Recombinant Mouse FNDC5 protein, His-tagged
Cat.No. : | FNDC5-10M |
Product Overview : | Recombinant Mouse FNDC5 protein is produced by E.coli expression system and the residues Leu74-Ile209 is expressed with a His tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | Leu74-Ile209 |
Molecular Mass : | 18 kDa |
AA Sequence : | LRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVIMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 90 % |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. |
Notes : | The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5 % within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Concentration : | 200 μg/mL |
Storage Buffer : | 20 mM Tris, 150 mM NaCl, pH 8.0, containing 1 mM EDTA, 1 mM DTT, 0.01 % SKL, 5 % Trehalose and Proclin 300. |
Reconstitution : | Reconstitute in 20 mM Tris, 150 mM NaCl (pH 8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | Fndc5 fibronectin type III domain containing 5 [ Mus musculus ] |
Official Symbol | FNDC5 |
Synonyms | FRCP2; Irisin; FNDC5; PeP; Pxp; 1500001L03Rik; |
Gene ID | 70364 |
◆ Recombinant Proteins | ||
FNDC5-102H | Recombinant Active Human FNDC5 Protein, His-tagged(C-ter) | +Inquiry |
Fndc5-632M | Recombinant Mouse Fndc5 protein(29-140aa), His-tagged | +Inquiry |
FNDC5-114H | Recombinant Human FNDC5 Protein (Asp32-Glu143), Animal-free, Carrier-free | +Inquiry |
FNDC5-7845H | Recombinant Human FNDC5 protein, His-tagged | +Inquiry |
FNDC5-2376R | Recombinant Rat FNDC5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNDC5-6172HCL | Recombinant Human FNDC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FNDC5 Products
Required fields are marked with *
My Review for All FNDC5 Products
Required fields are marked with *
0
Inquiry Basket