Recombinant Mouse Fam3b protein, hFc-tagged

• Cat.No.: Fam3b-4246M
• Product Overview: Recombinant Mouse Fam3b protein(Q9D309)(30-235aa), fused to C-terminal hFc tag, was expressed in Mammalian cell.

Specification

• Source: Mammalian cell
• Species: Mouse
• Tag: Fc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.9 kDa
• Protein length: 30-235aa
• AA Sequence: ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Fam3b family with sequence similarity 3, member B [ Mus musculus ]
• Official Symbol: Fam3b
• Synonyms: FAM3B; family with sequence similarity 3, member B; protein FAM3B; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; ORF9; Pander; D16Jhu19e; 9030624C24Rik
• Gene ID: 52793
• mRNA Refseq: NM_020622
• Protein Refseq: NP_065647