Recombinant Mouse EphA3 Protein, 21-541aa, C-His tagged

• Cat.No.: EphA3-04M
• Product Overview: Recombinant mouse EphA3, 21-541aa, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: 21-541aa
• Description: EphA3 is a protein-tyrosine kinase that belongs to the ephrin receptor subfamily. It has an extracellular region with a Cys-rich domain and two fibronectin type III repeats, and a single kinase domain. EPH and other EPHrelated receptors are involved in various developmental processes, especially in the nervous system. EphA3 interacts with EFNB2 and EFNA5, and is expressed in the forebrain, retinal axons, some motor neurons in the spinal cord, and the heart during development. It regulates axonal guidance and organ formation. It is also found on some blood and solid tumor cells, and on astrocytes near injured nerve tissue.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Human EFNA5.
• Molecular Mass: 59.5 kDa (527aa)
• AA Sequence: ELSPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCTCNAGYEERGFICQACRPGFYKASDGAAKCAKCPPHSSTQEDGSMNCRCENNYFRAEKDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDITFNIICKKCGWNVRQCEPCSPNVRFLPRQLGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQYAAVSITTNQAAPSPVMTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTTYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGENSH
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• References: 1. Kudo, C. et al. (2005) J. Comp. Neurol. 487:255-269.
  2. Kilpatrick, T.J. et al. (1996) Mol. Cell. Neurosci. 7:62-74.
  3. Stephen, L.J. et al. (2007) Dev. Biol. 302:66-79.
  4. Merlos-Suarez, A. and E. Batlle (2008) Curr. Opin. Cell Biol. 20:194-200.

Gene Information

• Gene Name: Epha3 Eph receptor A3 [ Mus musculus (house mouse) ]
• Official Symbol: EphA3
• Synonyms: EPHA3; Eph receptor A3; ephrin type-A receptor 3; EK4; EPH-like kinase 4; tyrosine-protein kinase TYRO4; tyrosine-protein kinase receptor ETK1; Hek; Cek4; ETK1; End3; Hek4; Mek4; Tyro4; AW492086
• Gene ID: 13837
• mRNA Refseq: NM_010140
• Protein Refseq: NP_034270
• UniProt ID: Q8BRB1