Recombinant Mouse EGFL8 Protein (29-293 aa), His-SUMO-Myc-tagged

• Cat.No.: EGFL8-2312M
• Product Overview: Recombinant Mouse EGFL8 Protein (29-293 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.

Specification

• Description: Interacting selectively and non-covalently with calcium ions (Ca2+).
• Source: E. coli
• Species: Mouse
• Tag: His&Myc&SUMO
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 49.0 kDa
• Protein length: 29-293 aa
• AA Sequence: GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Egfl8 EGF-like domain 8 [ Mus musculus ]
• Official Symbol: EGFL8
• Synonyms: EGFL8; EGF-like domain 8; epidermal growth factor-like protein 8; EGF-like protein 8; Ng3
• Gene ID: 81701
• mRNA Refseq: NM_152922
• Protein Refseq: NP_690886
• UniProt ID: Q6GUQ1