Recombinant Mouse Efna4 Protein, Fc-tagged

• Cat.No.: Efna4-050M
• Product Overview: Purified recombinant protein of Mouse ephrin A4 (Efna4) with C-terminal Fc tag was expressed in HEK293 cell.

Specification

• Species: Mouse
• Source: HEK293
• Tag: Fc
• Description: Broad expression in limb E14.5 (RPKM 20.7), ovary adult (RPKM 14.7) and 18 other tissues.
• Molecular Mass: 43.9 kDa
• AA Sequence: RHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: Efna4 ephrin A4 [ Mus musculus (house mouse) ]
• Official Symbol: Efna4
• Synonyms: Efna4; ephrin A4; Epl4; EFL-4; LERK-4; ephrin-A4; EPH-related receptor tyrosine kinase ligand 4
• Gene ID: 13639
• mRNA Refseq: NM_007910
• Protein Refseq: NP_031936
• UniProt ID: O08542