Description :	Broad expression in limb E14.5 (RPKM 20.7), ovary adult (RPKM 14.7) and 18 other tissues.
Source :	HEK293
Species :	Mouse
Tag :	Fc
Molecular Mass :	43.9 kDa
AA Sequence :	RHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
Endotoxin :	Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity :	>95%, as determined by SDS-PAGE and Coomassie blue staining
Stability :	Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage :	Store at -80 centigrade.
Storage Buffer :	Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
Reconstitution :	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Name	Efna4 ephrin A4 [ Mus musculus (house mouse) ]
Official Symbol	Efna4
Synonyms	Efna4; ephrin A4; Epl4; EFL-4; LERK-4; ephrin-A4; EPH-related receptor tyrosine kinase ligand 4
Gene ID	13639
mRNA Refseq	NM_007910
Protein Refseq	NP_031936
UniProt ID	O08542