Recombinant Mouse Cxcl9 protein, His-tagged

• Cat.No.: Cxcl9-2776M
• Product Overview: Recombinant Mouse Cxcl9 protein(P18340)(22-126aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 22-126aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 16.2 kDa
• AA Sequence: TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Cxcl9 chemokine (C-X-C motif) ligand 9 [ Mus musculus ]
• Official Symbol: Cxcl9
• Synonyms: CXCL9; chemokine (C-X-C motif) ligand 9; C-X-C motif chemokine 9; M119; protein m119; small-inducible cytokine B9; gamma interferon-induced monokine; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; small inducible cytokine B subfamily (Cys-X-Cys), member 9; CMK; Mig; MuMIG; Scyb9; crg-10; BB139920
• Gene ID: 17329
• mRNA Refseq: NM_008599
• Protein Refseq: NP_032625