| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
105 |
| Description : |
CXCL9 belongs to the CXC chemokine family and also known as Monokine induced by gamma interferon (MIG). It is a T-cell chemoattractant induced by IFN-γ. CXCL9 is closely related to two other CXC chemokines called CXCL10 and CXCL11, additionally they all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3. It is a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response and chemotactic for activated T-cells. Recombinant murine CXCL9 contains 105 amino acids which is a single non-glycosylated polypeptide chain. Furthermore, The murine CXCL9 shares 75% and 88% a.a. sequence identity with human and rat CXCL9. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 0.1-1.0 ng/ml. |
| Molecular Mass : |
Approximately 12.2 kDa, a single non-glycosylated polypeptide chain containing 105 amino acids. |
| AA Sequence : |
TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT |
| Endotoxin : |
Less than 1 EU/µg of rMuMIG/CXCL9 as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
