Recombinant Mouse Cxcl10 protein, GST-tagged

• Cat.No.: Cxcl10-2770M
• Product Overview: Recombinant Mouse Cxcl10 protein(P17515)(22-98aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: GST
• Protein Length: 22-98aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.7 kDa
• AA Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Cxcl10 chemokine (C-X-C motif) ligand 10 [ Mus musculus ]
• Official Symbol: Cxcl10
• Synonyms: CXCL10; chemokine (C-X-C motif) ligand 10; C-X-C motif chemokine 10; gamma-IP10; interferon activated gene 10; small-inducible cytokine B10; interferon-gamma induced protein CRG-2; interferon-gamma-induced protein CRG-2; 10 kDa interferon gamma-induced protein; small inducible cytokine B subfamily (Cys-X-Cys), member 10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
• Gene ID: 15945
• mRNA Refseq: NM_021274
• Protein Refseq: NP_067249