Recombinant Mouse Cxcl10 protein, GST-tagged

Cat.No. : Cxcl10-2770M
Product Overview : Recombinant Mouse Cxcl10 protein(P17515)(22-98aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : GST
Protein Length : 22-98aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 35.7 kDa
AA Sequence : IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Cxcl10 chemokine (C-X-C motif) ligand 10 [ Mus musculus ]
Official Symbol Cxcl10
Synonyms CXCL10; chemokine (C-X-C motif) ligand 10; C-X-C motif chemokine 10; gamma-IP10; interferon activated gene 10; small-inducible cytokine B10; interferon-gamma induced protein CRG-2; interferon-gamma-induced protein CRG-2; 10 kDa interferon gamma-induced protein; small inducible cytokine B subfamily (Cys-X-Cys), member 10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10;
Gene ID 15945
mRNA Refseq NM_021274
Protein Refseq NP_067249

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Cxcl10 Products

Required fields are marked with *

My Review for All Cxcl10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon