Recombinant Mouse Cx3cl1 protein
Cat.No. : | Cx3cl1-949M |
Product Overview : | Recombinant Mouse Cx3cl1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 76 |
Description : | This gene belongs to the CX3C subgroup of chemokines, characterized by the number of amino acids located between the conserved cysteine residues. This is the only member of the CX3C subgroup, which contains three amino acids between cysteine residues, resulting in a Cys-X-X-X-Cys configuration. The encoded protein contains an extended mucin-like stalk with a chemokine domain on top, and exists in both a membrane-anchored form where it acts as a binding molecule, or, in soluble form, as a chemotactic cytokine. The mature form of this protein can be cleaved at the cell surface, yielding different soluble forms that can interact with the G-protein coupled receptor, C-X3-C motif chemokine receptor 1 gene product. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human peripheral blood lymphocytes (PBL) is less than 0.5 μg/ml, corresponding to a specific activity of > 2000 IU/mg. |
Molecular Mass : | Approximately 8.7 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids and comprises only the chemokine domain of Murine Fractalkine. |
AA Sequence : | QHLGMTKCEIMCGKMTSRIPVALLIRYQLNQESCGKRAIVLETTQHRRFCADPKEKWVQDAMKHLDHQAAALTKNG |
Endotoxin : | Less than 0.1 EU/µg of rMuFractalkine/CX3CL1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Cx3cl1 |
Official Symbol | Cx3cl1 |
Synonyms | CX3CL1; chemokine (C-X3-C motif) ligand 1; fractalkine; neurotactin; C-X3-C motif chemokine 1; small-inducible cytokine D1; CX3C membrane-anchored chemokine; small inducible cytokine subfamily D, 1; CX3C; Cxc3; Scyd1; ABCD-3; AB030188; AI848747; D8Bwg0439e; |
Gene ID | 20312 |
mRNA Refseq | NM_009142 |
Protein Refseq | NP_033168 |
UniProt ID | O35188 |
◆ Recombinant Proteins | ||
RFL18747RF | Recombinant Full Length Rat Fractalkine(Cx3Cl1) Protein, His-Tagged | +Inquiry |
CX3CL1-176C | Recombinant Canine CX3CL1, LEVLFQ tagged | +Inquiry |
Cx3cl1-5746M | Recombinant Mouse Cx3cl1 Protein (Gln25-Arg337), C-His tagged | +Inquiry |
CX3CL1-482H | Recombinant Human CX3CL1 Protein | +Inquiry |
CX3CL1-2092M | Recombinant Mouse CX3CL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CX3CL1-840CCL | Recombinant Canine CX3CL1 cell lysate | +Inquiry |
CX3CL1-3019HCL | Recombinant Human CX3CL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cx3cl1 Products
Required fields are marked with *
My Review for All Cx3cl1 Products
Required fields are marked with *
0
Inquiry Basket