Recombinant Mouse Ctla4 protein, His-SUMO & Myc-tagged

• Cat.No.: Ctla4-2755M
• Product Overview: Recombinant Mouse Ctla4 protein(P09793)(36-161aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 36-161aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.9 kDa
• AA Sequence: EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Ctla4 cytotoxic T-lymphocyte-associated protein 4 [ Mus musculus ]
• Official Symbol: Ctla4
• Synonyms: CTLA4; cytotoxic T-lymphocyte-associated protein 4; cytotoxic T-lymphocyte protein 4; CD152 antigen; cytotoxic T-lymphocyte-associated antigen 4; Cd152; Ly-56; Ctla-4
• Gene ID: 12477
• mRNA Refseq: NM_009843
• Protein Refseq: NP_033973