Recombinant Mouse Cst7 protein, His-tagged

• Cat.No.: Cst7-930M
• Product Overview: Recombinant Mouse Cst7(Ala19-Gln144) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: Ala19-Gln144
• Description: Mouse Cystatin F belongs to cystatin superfamily, which encompasses proteins that contain multiple cystatin-like sequences. It has been shown that Cystatin F is selectively expressed by hematopoietic cells and may be a biomarker for both liver metastasis and inflammatory lung disorders. Mouse Cystatin F inhibits papain and cathepsin L but with affinities lower than other cystatins. It may play a role in immune regulation through inhibition of a unique target in the hematopoietic system.
• Form: Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.
• AA Sequence: ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVK GLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQVDHH HHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.
  Please minimize freeze-thaw cycles.
• Shipping: The product is shipped on dry ice/ice packs.

Gene Information

• Gene Name: Cst7 cystatin F (leukocystatin) [ Mus musculus ]
• Official Symbol: cst7
• Synonyms: CST7; cystatin F (leukocystatin); cystatin-F; cystatin 7; cystatin-7; cystatin-like metastasis-associated protein; Cmap; MGC151424; MGC151426
• Gene ID: 13011
• mRNA Refseq: NM_009977
• Protein Refseq: NP_034107
• UniProt ID: O89098
• Chromosome Location: 2; 2 G1-G3
• Function: cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity