Recombinant Mouse CSAD Protein (1-493 aa), His-SUMO-tagged

• Cat.No.: CSAD-428M
• Product Overview: Recombinant Mouse CSAD Protein (1-493 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-493 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 71.1 kDa
• AA Sequence: MADSKPLRTLDGDPVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILAQADIDFLLGELELLGQDL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Csad cysteine sulfinic acid decarboxylase [ Mus musculus ]
• Official Symbol: CSAD
• Synonyms: CSAD; sulfinoalanine decarboxylase; Csd
• Gene ID: 246277
• mRNA Refseq: NM_144942
• Protein Refseq: NP_659191
• UniProt ID: Q9DBE0