Recombinant Mouse CLTRN Protein (15-141 aa), His-SUMO-Myc-tagged

• Cat.No.: CLTRN-2258M
• Product Overview: Recombinant Mouse CLTRN Protein (15-141 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Description: Regulator of SNARE complex function. Stimulator of beta cell replication.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 34.5 kDa
• Protein length: 15-141 aa
• AA Sequence: ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Cltrn collectrin, amino acid transport regulator [ Mus musculus (house mouse) ]
• Official Symbol: CLTRN
• Synonyms: Cltrn; NX17; NX-17; Tmem27; 0610008J07Rik
• Gene ID: 57394
• mRNA Refseq: NM_001313719
• Protein Refseq: NP_001300648
• UniProt ID: Q9ESG4