Recombinant Mouse CLEC4A Protein (70-238 aa), His-SUMO-Myc-tagged

• Cat.No.: CLEC4A-2212M
• Product Overview: Recombinant Mouse CLEC4A Protein (70-238 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Description: May be involved in regulating immune reactivity. May play a role in modulating dendritic cells (DC) differentiation and/or maturation. May be involved in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.
• Source: E. coli
• Species: Mouse
• Tag: His&Myc&SUMO
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 39.6 kDa
• Protein length: 70-238 aa
• AA Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Clec4a2 C-type lectin domain family 4, member a2 [ Mus musculus (house mouse) ]
• Official Symbol: CLEC4A
• Synonyms: Clec4a; DCIR; Dcir1; Clec4a; Clecsf6
• Gene ID: 26888
• mRNA Refseq: NM_001170332
• Protein Refseq: NP_001163803
• UniProt ID: Q9QZ15