Recombinant Mouse Ccn6 protein(24-354aa), His-tagged
Cat.No. : | Ccn6-6321M |
Product Overview : | Recombinant Mouse Ccn6 protein(D3Z5L9)(24-354aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
ProteinLength : | 24-354aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.8 kDa |
AASequence : | SAPQDSTPGGRPGAALEVYQRTEVCRWPCRCPPQRPTCPPGVSLVRDGCGCCKVCAKQPGDTCNEAEICDPHKGLYCDYSGDTPRYETGVCAYLVAVGCEFNRVYYQNGQVFQPHPLFSCLCVSGAIGCTPLFIPKLAGSNCSAAKGRRKTDPPNCGRGTLQQQNSASYKTMSAYRNLPLTWRKKCLVQATKWTPCSRTCGMGISNRVTNDNANCEMRKERRLCYIQPCSRNTSQAVKIPRGETCQPTFQLPKAEKFVFSGCSSTQSYRPTFCGICLDKRCCVPNKSKMITVRFDCPSEGSFKWQMLWVTSCVCQRDCREPGDIFSELRIL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
PLP1-3293R | Recombinant Rhesus Macaque PLP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
C5-5355P | Recombinant Pig C5 protein, His-tagged | +Inquiry |
ME1-18H | Recombinant Human ME1 Protein, C-6×His tagged | +Inquiry |
MAPK9-2421H | Recombinant Human MAPK9 Protein, His-tagged | +Inquiry |
RFL36431BF | Recombinant Full Length Bacillus Anthracis Upf0397 Protein Baa_2707 (Baa_2707) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1792A | Active Native Artocarpus integrifolia Jacalin Protein, Agarose bound | +Inquiry |
Heparin-200S | Active Native Swine Heparin | +Inquiry |
IgA-259H | Native Human Secretory Immunoglobulin A | +Inquiry |
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSB-1466HCL | Recombinant Human SSB 293 Cell Lysate | +Inquiry |
RPL37A-2197HCL | Recombinant Human RPL37A 293 Cell Lysate | +Inquiry |
ACTL9-1098HCL | Recombinant Human ACTL9 cell lysate | +Inquiry |
POLR2J2-3029HCL | Recombinant Human POLR2J2 293 Cell Lysate | +Inquiry |
RAD54L-2552HCL | Recombinant Human RAD54L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Ccn6 Products
Required fields are marked with *
My Review for All Ccn6 Products
Required fields are marked with *
0
Inquiry Basket