Recombinant Mouse CCL8 Protein

Cat.No. : CCL8-35M
Product Overview : Recombinant Mouse CCL8 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Monocyte chemotactic protein 2 (MCP-2), also known as CCL8, is a cytokine that is important during allergic and inflammatory responses. MCP-2 activates mast cells, eosinophils, and basophils through the G protein-coupled chemokine receptors CCR1, CCR2B, and CCR5.
Source : E. coli
Species : Mouse
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 8.5 kDa (74 aa)
AA Sequence : GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Ccl8 chemokine (C-C motif) ligand 8 [ Mus musculus (house mouse) ]
Official Symbol CCL8
Synonyms CCL8; chemokine (C-C motif) ligand 8; C-C motif chemokine 8; small inducible cytokine A8; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; monocyte chemoattractant protein-2; HC14; Mcp2; MCP-2; Scya8; AB023418; 1810063B20Rik;
Gene ID 20307
mRNA Refseq NM_021443
Protein Refseq NP_067418
UniProt ID Q9Z121

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL8 Products

Required fields are marked with *

My Review for All CCL8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon